DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Ser6

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:269 Identity:81/269 - (30%)
Similarity:125/269 - (46%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMFWMLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHC 72
            |:|.:|.::.:..     :.:.|:|||..:.....||.|::|..|:..||||::|...:||||||
  Fly    14 LLFLVLPVQSAPG-----KLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHC 73

  Fly    73 LNDGNPSD---------FVVRGGVTYLSDMRNSRY-------VRKILMPSAYSRTTLDHDVALLQ 121
            :::.:.:.         |.:|.|       .|.|:       |.::::...|....  :|||||:
  Fly    74 VSNEDVNHVITPIAAERFTIRAG-------SNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLR 129

  Fly   122 LKQP--LQASIAKPISL-AVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLY 183
            |:.|  |.||| :||.| .|.:|.....| :||||...... .||..||...::.:.:::|.:|.
  Fly   130 LESPLILSASI-QPIDLPTVDTPADVDVV-ISGWGRIKHQG-DLPRYLQYNTLKSITRQQCEELI 191

  Fly   184 R-GYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSW-----GRAHRCAARDSPGVYS 242
            . |:    ....|........||.||||||.|.:|. ||||..:     |..:       |..|:
  Fly   192 DFGF----EGELCLLHQVDNGACNGDSGGPAVYNNQ-LVGVAGFVVDGCGSTY-------PDGYA 244

  Fly   243 DVSYLSDWI 251
            .|.|..|||
  Fly   245 RVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 76/245 (31%)
Tryp_SPc 31..254 CDD:238113 77/246 (31%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 76/245 (31%)
Tryp_SPc 32..256 CDD:238113 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.