DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG33159

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:262 Identity:98/262 - (37%)
Similarity:153/262 - (58%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LPLMFWMLWIRESVAEELELRRS---PRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVL 67
            |.|::|:..:      .|.|..|   .|||||..:.:...|::|.:|:.|.|.|||||::.|.||
  Fly     4 LRLLWWLCHL------ALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVL 62

  Fly    68 TAAHCLNDGNPSDFVVRGGVTYLSDMRNSRYVRKILM----PSAYSRTTLDHDVALLQLKQPLQA 128
            :||||:....|..|.|..|.:.|.  :.:..||.::|    || ||.|..|.|||||||::.:..
  Fly    63 SAAHCVYGSQPEGFTVHAGASRLD--QEAPVVRNVVMFHTSPS-YSATNFDMDVALLQLQEVVVL 124

  Fly   129 SIAKPISLA-VRSPRPG-SFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITS 191
            :..|..::: .|:|..| ::.|:||||:|..::.....|:::..|:|:|..||:..|.||..::.
  Fly   125 TPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSD 189

  Fly   192 SMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIH 256
            ||.||:|.||:|:|:||||||:| ..|.:.|:||||  ..||....||||::|:      ::.:|
  Fly   190 SMLCAAVRGLRDSCSGDSGGPLV-YRGQVCGIVSWG--FGCARPSFPGVYTNVA------SERVH 245

  Fly   257 RY 258
            .:
  Fly   246 EF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 91/226 (40%)
Tryp_SPc 31..254 CDD:238113 90/228 (39%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 91/227 (40%)
Tryp_SPc 26..251 CDD:238113 91/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455625
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.