DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG31267

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:274 Identity:77/274 - (28%)
Similarity:119/274 - (43%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MLLPLMFWMLWIRESVAEELELRR--------------SPRIVGGHPSDVWHQPHMVNIRRR-GN 53
            :||.|.|          .|..|||              |.|||||..|||...|::|:::.. ||
  Fly    14 VLLALSF----------SEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGN 68

  Fly    54 FECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMRNSR----YVRKILMPSAYSRTTLD 114
            ..|.||::..:.|:|||.||.....::..|   ||...:...|.    .|..|:|...:......
  Fly    69 HFCAGSIIHDQWVITAASCLAGLRKNNVQV---VTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYH 130

  Fly   115 HDVALLQLKQPLQ-ASIAKPISLA-VRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQR 177
            :|:||::...... ..:.:.|::| :.....|..:.:.|:|.|:... ....|||.:.|..:...
  Fly   131 NDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGG-DFSWQLQQLDVTYVAPE 194

  Fly   178 ECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYS 242
            :|...|.|..::.....||.......||.||:|||:|:|.|.||||.:||..   .....|.|::
  Fly   195 KCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVP---CGYGFPDVFA 256

  Fly   243 DVSYLSDWIADNIH 256
            .:|:...||...|:
  Fly   257 RISFYYSWIISTIN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 65/227 (29%)
Tryp_SPc 31..254 CDD:238113 66/229 (29%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/227 (29%)
Tryp_SPc 45..268 CDD:238113 66/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.