DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG32755

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:247 Identity:81/247 - (32%)
Similarity:130/247 - (52%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PRIVGGHPSDVWHQPHMVNIRRRGNFE--------CGGSLVTPRCVLTAAHC--LNDG------N 77
            |:||||:...:...|..|::|||...|        |||::::.|.|.:||||  :|..      :
  Fly    36 PKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRD 100

  Fly    78 PSDFVVRGGVTYLSDMRNSRY-----VRKILMPSAYSRTTLDHDVALLQLKQ--PLQASIAKPIS 135
            |..:||..|.:.:.  |..|:     |::|:....|:.:||::|:|||.|..  |.::...:.|.
  Fly   101 PELYVVVAGSSAID--RTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIP 163

  Fly   136 LAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCAS-VP 199
            ||:::|..|:...:.|||.......|.  .||...|.::.:..|:.:|:    :.:|..||. :.
  Fly   164 LAIKAPEEGTTCLIHGWGKVTMKEKSA--SLQQAPVPILNKELCQVIYK----LPASQMCAGFLQ 222

  Fly   200 GLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            |..|||.||||||:: .:|.|.|::|||..  ||....||||::||:...||
  Fly   223 GGIDACQGDSGGPLI-CDGRLAGIISWGVG--CADPGYPGVYTNVSHFLKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 78/244 (32%)
Tryp_SPc 31..254 CDD:238113 80/245 (33%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 78/244 (32%)
Tryp_SPc 38..273 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.