DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG6041

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:255 Identity:86/255 - (33%)
Similarity:132/255 - (51%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFE--------CGGSLVTPRCVLTAAHC- 72
            ||::.|...:..|:||||:.:.:....:.|:||...|.:        |||.:::.|.|.||||| 
  Fly    21 ESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCC 85

  Fly    73 -LND----GNPSDFVVRGGVTYL---SDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQAS 129
             :.|    ....:||:..|.|||   :|.....|:::::....|:...|.:|:||:.:...:..:
  Fly    86 YITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWN 150

  Fly   130 IAKPISLAVRSP--RPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSS 192
            .....:||:.|.  ...:...:|||||...:.|...|.||:..|.::....||   ..|.:|..|
  Fly   151 WPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCR---ISYNSIPVS 212

  Fly   193 MFCAS-VPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            ..||. :.|..|||.|||||| ::.||:|.|:||:|..  |||...||||::|||..|||
  Fly   213 QVCAGYLSGGVDACQGDSGGP-MSCNGMLAGIVSYGAG--CAAPGYPGVYTNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/240 (33%)
Tryp_SPc 31..254 CDD:238113 82/241 (34%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 80/240 (33%)
Tryp_SPc 35..272 CDD:238113 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.