DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG3795

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:272 Identity:77/272 - (28%)
Similarity:121/272 - (44%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ESVAEELELRRSPR----------IVGGHPSDVWHQPHMVNIRRRG--------NFECGGSLVTP 63
            ||.|.:|....|.|          :.||:..|...........|.|        |..|.|::.:.
  Fly    22 ESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSE 86

  Fly    64 RCVLTAAHCLNDGN-----PSDFVVRGGVTYLSDMRNSRYV--RKILMPSAYSR-TTLDHDVALL 120
            |.:||||||:....     ....||.|....|.....::.:  .::|....|.: .:..:|:.|:
  Fly    87 RAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLI 151

  Fly   121 QLKQPLQA--SIAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLY 183
            .|:..|..  ::|| |.|..:.|..|:...:.||| |......||::..:..:|::|...|..|.
  Fly   152 LLEADLSLGDAVAK-IPLYNKVPVAGAPCSIVGWG-TVIQFGPLPDEAINGDMQILPDTFCEKLL 214

  Fly   184 RGYRNITSSMFCAS------VPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYS 242
             |:.|  :.|.||:      |    |:|.||||||::..| ::.|:||:|..  |...||.|:|:
  Fly   215 -GWSN--AGMLCANDKHDSDV----DSCQGDSGGPLICDN-MVTGIVSFGMG--CGEPDSAGIYT 269

  Fly   243 DVSYLSDWIADN 254
            ||.:..|||.:|
  Fly   270 DVYHFRDWITEN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 69/254 (27%)
Tryp_SPc 31..254 CDD:238113 70/246 (28%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/232 (29%)
Tryp_SPc 60..278 CDD:214473 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.