DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG14780

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:269 Identity:99/269 - (36%)
Similarity:134/269 - (49%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMFWMLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNI---RRRGNFE----CGGSLVTPRC 65
            ::||.|  ....|.:|:..:..||:.|..:......|:|:|   |...||.    |||:|:.||.
  Fly    12 ILFWFL--LACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRK 74

  Fly    66 VLTAAHCLNDG------NPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRT----TLDHDVALL 120
            ||||||||.:.      ..|:|||..|.....:.||...|.:: ...||..|    ::..||.:|
  Fly    75 VLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQV-SSMAYMHTFSPDSMRDDVGIL 138

  Fly   121 QLKQPLQAS-------IAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRE 178
            .|:..|..|       ...||.||.:...||...:|:|||.|:.|  ||.|.|.:.:|..:..:.
  Fly   139 FLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQS--SLSNILLTANVSTIRHQT 201

  Fly   179 CRDLYRGYRNITSSMFCAS-VPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYS 242
            ||.:||.  .:...|.||. :.|..|:|.||||||:|: .|.||||||||  :.||....||||.
  Fly   202 CRMIYRS--GLLPGMMCAGRLQGGTDSCQGDSGGPLVH-EGRLVGVVSWG--YGCAEPGLPGVYV 261

  Fly   243 DVSYLSDWI 251
            ||.|...||
  Fly   262 DVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 92/245 (38%)
Tryp_SPc 31..254 CDD:238113 93/246 (38%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 92/245 (38%)
Tryp_SPc 33..271 CDD:238113 93/246 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.