DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Klk10

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:270 Identity:78/270 - (28%)
Similarity:122/270 - (45%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MLLPLMFWMLWIRESV-------AEELEL--RRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGS 59
            :||||:...||..:::       .|:||.  ...|.:         .||..|::.....|:|.|.
  Rat    20 LLLPLLMMQLWAAQALLLPGNTTREDLEAFGTLCPSV---------SQPWQVSLFHNLQFQCAGV 75

  Fly    60 LVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSR-----------TTL 113
            ||....|||||||..:   .....|.|..:|. :..|..:|....|..:.:           .:.
  Rat    76 LVDQNWVLTAAHCWRN---KPLRARVGDDHLL-LFQSEQLRSTNSPVFHPKYQPCSGPVLPLRSD 136

  Fly   114 DHDVALLQLKQP-LQASIAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQR 177
            :||:.:|:|..| :..|...|:.|..:..:|....:|||||.|.:........|....|.::.|:
  Rat   137 EHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRSLSCSRVTLLSQK 201

  Fly   178 ECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRC-AARDSPGVY 241
            :|...|.|.  ||::|.||.:...:|:|..|||||:|..| .|.|::||. .:.| ||...|.||
  Rat   202 QCETFYPGV--ITNNMICAGMDRDQDSCQSDSGGPLVCDN-TLHGILSWS-IYPCGAATQYPAVY 262

  Fly   242 SDVSYLSDWI 251
            :.:...::||
  Rat   263 AKICNYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 66/233 (28%)
Tryp_SPc 31..254 CDD:238113 68/234 (29%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.