DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and LOC286960

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:262 Identity:92/262 - (35%)
Similarity:135/262 - (51%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MLLPLMFWMLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLT 68
            |.:.:.|..|    ..|..|.:....:||||:.......|:.|::....:.:|||||::.:.||:
  Rat     1 MKISIFFAFL----GAAVALPVNDDDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLS 61

  Fly    69 AAHC------LNDGNPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQP-- 125
            ||||      :..|..:..|:.||..::.       ..||:....|::.|||:|:.|::||.|  
  Rat    62 AAHCYKRKLQVRLGEHNIHVLEGGEQFID-------AEKIIRHPEYNKDTLDNDIMLIKLKSPAV 119

  Fly   126 LQASIAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNIT 190
            |.:.:: .:||........:...|||||.|.|.....|..||.:...|:....|:..|.|  .||
  Rat   120 LNSQVS-TVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPG--QIT 181

  Fly   191 SSMFCAS-VPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDV-SYLSDWIAD 253
            |:|||.. :.|.||:|.|||||||| .||.:.|:||||..  ||.|..||||:.| :||| ||.:
  Rat   182 SNMFCLGFLEGGKDSCDGDSGGPVV-CNGEIQGIVSWGSV--CAMRGKPGVYTKVCNYLS-WIQE 242

  Fly   254 NI 255
            .:
  Rat   243 TM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 85/230 (37%)
Tryp_SPc 31..254 CDD:238113 87/232 (38%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 85/230 (37%)
Tryp_SPc 24..243 CDD:238113 87/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.