DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Klk1c2

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:237 Identity:78/237 - (32%)
Similarity:120/237 - (50%) Gaps:24/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMR 94
            |||||:..:...||..|.:  ...:.|||.|:.|..|:|||||.:: |....:.|..:.......
  Rat    24 RIVGGYKCEKNSQPWQVAV--INEYLCGGVLIDPSWVITAAHCYSN-NYQVLLGRNNLFKDEPFA 85

  Fly    95 NSRYVRK---------ILMPSAYSRTTLDH--DVALLQLKQPLQASI---AKPISLAVRSPRPGS 145
            ..|.||:         :::.:...:...||  |:.||.|.:|  |.|   .|.|.|..:.|:.||
  Rat    86 QRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEP--ADITGGVKVIDLPTKEPKVGS 148

  Fly   146 FVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCA-SVPGLKDACAGDS 209
            ....||||.|:.|...:.:.||.|::.::...:|.:.|:.  |:|..|.|| .:.|.||.|||||
  Rat   149 TCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKD--NVTDVMLCAGEMEGGKDTCAGDS 211

  Fly   210 GGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            |||:: .:|:|.|:.| |.|..||...:|.:|:.:...:.||
  Rat   212 GGPLI-CDGVLQGITS-GGATPCAKPKTPAIYAKLIKFTSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 76/235 (32%)
Tryp_SPc 31..254 CDD:238113 77/236 (33%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.