DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and PRSS55

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:241 Identity:79/241 - (32%)
Similarity:122/241 - (50%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGN--PSDF-VVRGGVT 88
            |..||.||..::|...|..|:|:.|....||||::....:|||||||....  |.:. ||.|...
Human    64 RYSRITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGTND 128

  Fly    89 YLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQASIAK-PISLAVRSPRPGSFVR--VS 150
            ..|.....:.|..|::...:.|..:|:|:|||.|..|::....| ||.|..: |.|.::..  |:
Human   129 LTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQ-PGPATWRECWVA 192

  Fly   151 GWGLTDSS-STSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLK----DACAGDSG 210
            |||.|::: ..|:...|....:.:|...||..:   :..:|.:|.||   |.|    |||.||||
Human   193 GWGQTNAADKNSVKTDLMKAPMVIMDWEECSKM---FPKLTKNMLCA---GYKNESYDACKGDSG 251

  Fly   211 GPVV-----NSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            ||:|     ......||::|||::  |..:::||:|:.:...:.||
Human   252 GPLVCTPEPGEKWYQVGIISWGKS--CGEKNTPGIYTSLVNYNLWI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 76/236 (32%)
Tryp_SPc 31..254 CDD:238113 77/237 (32%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 76/236 (32%)
Tryp_SPc 68..298 CDD:238113 77/237 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.