DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and try-1

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:249 Identity:90/249 - (36%)
Similarity:120/249 - (48%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVN-IRRRGNFECGGSLVTPRCVLTAAHCL-NDGNPSDFVVRGG------ 86
            |::||..|.....|..|. :.|.|:..|||||:.|..|||||||. .|..|:.:.||.|      
 Worm    57 RLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHRSGS 121

  Fly    87 -----VTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQAS-IAKPISLAVRSPRPGS 145
                 ||.:|  .:..|  .|..||:|       |.|::::..|:..| .|:||.|.........
 Worm   122 GSPHRVTAVS--IHPWY--NIGFPSSY-------DFAIMRIHPPVNTSTTARPICLPSLPAVENR 175

  Fly   146 FVRVSGWGLT-DSSSTSLPNQLQSVHVQVMPQRECRDL--YRGYRNITSSMFCASVP-GLKDACA 206
            ...|:|||.| :.||.|.|. |:.:||.::....|..|  |.| |....||.||... |..|:|.
 Worm   176 LCVVTGWGSTIEGSSLSAPT-LREIHVPLLSTLFCSSLPNYIG-RIHLPSMLCAGYSYGKIDSCQ 238

  Fly   207 GDSGGPVV---NSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIHR 257
            ||||||::   :.:..|.||||||..  ||....||||.:|...|.||...::|
 Worm   239 GDSGGPLMCARDGHWELTGVVSWGIG--CARPGMPGVYGNVHSASTWINLEMNR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 87/241 (36%)
Tryp_SPc 31..254 CDD:238113 88/243 (36%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 87/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.