DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Klkb1

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:239 Identity:86/239 - (35%)
Similarity:126/239 - (52%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIRRR---GNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVR--GGVTY 89
            |||||..:.:...|..|:::.:   ....||||::..:.|||||||. ||.|...|.|  ||:..
Mouse   390 RIVGGTNASLGEWPWQVSLQVKLVSQTHLCGGSIIGRQWVLTAAHCF-DGIPYPDVWRIYGGILS 453

  Fly    90 LSDMRN---SRYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSFVR-- 148
            ||::..   |..::::::...|..:..::|:||::|:.||. ....|||.|..::.....:..  
Mouse   454 LSEITKETPSSRIKELIIHQEYKVSEGNYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCW 518

  Fly   149 VSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASV-PGLKDACAGDSGGP 212
            |:|||.|.....: .|.||...:.::|..||:..||.| .|...|.||.. .|..|||.||||||
Mouse   519 VTGWGYTKEQGET-QNILQKATIPLVPNEECQKKYRDY-VINKQMICAGYKEGGTDACKGDSGGP 581

  Fly   213 VV---NSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIAD 253
            :|   :....|||:.|||..  ||.:|.||||:.||...|||.:
Mouse   582 LVCKHSGRWQLVGITSWGEG--CARKDQPGVYTKVSEYMDWILE 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 84/235 (36%)
Tryp_SPc 31..254 CDD:238113 85/238 (36%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 84/235 (36%)
Tryp_SPc 391..621 CDD:238113 83/234 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.