DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Try5

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:235 Identity:88/235 - (37%)
Similarity:130/235 - (55%) Gaps:23/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMR 94
            :||||:.......|:.|::....:| |||||:..:.|::||||..    |...||.|...::.:.
  Rat    23 KIVGGYTCQENSVPYQVSLNSGYHF-CGGSLINDQWVVSAAHCYK----SRIQVRLGEHNINVLE 82

  Fly    95 -NSRYVR--KILMPSAYSRTTLDHDVALLQLKQPLQ-----ASIAKPISLAVRSPRPGSFVRVSG 151
             |.::|.  ||:....::...|::|:.|::|..|:.     |::|.|.|.|    ..|:...:||
  Rat    83 GNEQFVNAAKIIKHPNFNARNLNNDIMLIKLSVPVTLNSRVATVALPSSCA----PAGTQCLISG 143

  Fly   152 WGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCAS-VPGLKDACAGDSGGPVVN 215
            ||.|.|...:.|:.||.:...|:||.:|...|.|  .||::|.|.. :.|.||:|.|||||||| 
  Rat   144 WGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPG--KITNNMICVGFLEGGKDSCQGDSGGPVV- 205

  Fly   216 SNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255
            .||.|.|:||||  :.||.:|:||||:.|....|||.|.|
  Rat   206 CNGQLQGIVSWG--YGCALKDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 84/229 (37%)
Tryp_SPc 31..254 CDD:238113 86/231 (37%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 84/229 (37%)
Tryp_SPc 24..242 CDD:238113 86/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.