DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and f12

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:257 Identity:85/257 - (33%)
Similarity:120/257 - (46%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLS-D 92
            ||||||..:.....|::..:....:| |||||::|..::||||||:.        |..||.:| .
 Frog   357 PRIVGGLVALPASHPYIAALYIDNHF-CGGSLISPCWIVTAAHCLDQ--------RPNVTKISVV 412

  Fly    93 MRNSRY-----------VRKILMPSAYSRTTLDHDVALLQLK--QPLQAS----IAKPISLAVRS 140
            :..||:           |.|.::...|...||.||:||:::|  ..|.||    ..:||.|    
 Frog   413 LGQSRFNTTDQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICL---- 473

  Fly   141 PRPGSFVR--------VSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCAS 197
              |..|..        |:|||.....:......||...:.::|..:|:........:...|.||.
 Frog   474 --PQQFKMAESTKQCVVAGWGHQYEGAEHYAFFLQEASMPIIPYTQCQSPSVHGDRMLPGMLCAG 536

  Fly   198 -VPGLKDACAGDSGGPV---VNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255
             :.|..|||.||||||:   |:....|.||||||..  ||..:.||||:.|:..:|||..||
 Frog   537 FMEGGVDACQGDSGGPLVCEVDGRIELHGVVSWGSG--CAEENKPGVYTAVTSYTDWIRANI 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/250 (32%)
Tryp_SPc 31..254 CDD:238113 81/252 (32%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 81/252 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.