DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and gzm3.4

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:242 Identity:65/242 - (26%)
Similarity:107/242 - (44%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMRN 95
            ||||....:..:|:|.:::.:....|||.|:....|||:|||..|....:.|:  |...:|...|
Zfish    25 IVGGREVKLHSRPYMASLQVQRKHNCGGILIKEDYVLTSAHCWKDTTNLEVVL--GAHNISQREN 87

  Fly    96 SR---YVRKILMPSAYSRTTLDHDVALLQLKQPL--------------QASIAKPISLAVRSPRP 143
            |:   .|:|.:....|.:.....|:.||:||...              :.||..|:..:      
Zfish    88 SQQIIQVQKYIKHPNYQKKNHSFDIMLLKLKTKAVLNHFVNITNLPKHEPSILAPVECS------ 146

  Fly   144 GSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGD 208
                 ::|||: ........|.|:.|::|:.....|:..::.|.| :.:|.|.:..|.|..|.||
Zfish   147 -----IAGWGM-QRPGEGASNVLREVNLQLESNSYCKSKWQVYFN-SKNMVCTASDGKKAFCQGD 204

  Fly   209 SGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255
            ||.|:. .|..|.|:.::...:.|..::.|.||..||....||..|:
Zfish   205 SGSPLF-CNSELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWIKKNM 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 62/236 (26%)
Tryp_SPc 31..254 CDD:238113 64/239 (27%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 64/239 (27%)
Tryp_SPc 25..246 CDD:214473 62/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.