DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33841 and HTA12

DIOPT Version :10

Sequence 1:NP_001027346.1 Gene:His2A:CG33841 / 3772360 FlyBaseID:FBgn0053841 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001190208.1 Gene:HTA12 / 831891 AraportID:AT5G02560 Length:177 Species:Arabidopsis thaliana


Alignment Length:147 Identity:91/147 - (61%)
Similarity:102/147 - (69%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE----- 61
            :||..||..|.|..|||.::|||||||||.|.|:||.|::|||.|||||||||:||||||     
plant    12 AGRRSGGGPKKKPVSRSVKSGLQFPVGRIGRYLKKGRYSKRVGTGAPVYLAAVLEYLAAENSCGF 76

  Fly    62 -------------------VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGV 107
                               ||||||||||||||.||||||:.||:||||||..||.|||||.|||
plant    77 CSVASLTIYRCRMSSSDFRVLELAGNAARDNKKNRIIPRHVLLAVRNDEELGTLLKGVTIAHGGV 141

  Fly   108 LPNIQAVLLPKKTEKKA 124
            ||||..:|||||:||.|
plant   142 LPNINPILLPKKSEKAA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33841NP_001027346.1 PTZ00017 16..124 CDD:185399 84/131 (64%)
HTA12NP_001190208.1 PLN00157 20..164 CDD:177758 87/139 (63%)

Return to query results.
Submit another query.