DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33841 and h2az2b

DIOPT Version :9

Sequence 1:NP_001027346.1 Gene:His2A:CG33841 / 3772360 FlyBaseID:FBgn0053841 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001036788.1 Gene:h2az2b / 403077 ZFINID:ZDB-GENE-050506-24 Length:128 Species:Danio rerio


Alignment Length:128 Identity:79/128 - (61%)
Similarity:93/128 - (72%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAK----SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAA 60
            |:| ||.||..||||    |||.|||||||||||||.|:....:. ||||.|.||.||::|||.|
Zfish     1 MAG-GKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTA 64

  Fly    61 EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123
            |||||||||::|.|..||.|||||||||.||||:.|:. .|||.|||:|:|...|:.||.::|
Zfish    65 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33841NP_001027346.1 PTZ00017 16..124 CDD:185399 69/109 (63%)
h2az2bNP_001036788.1 PLN00154 6..121 CDD:177756 72/115 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.