DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33817 and HTA2

DIOPT Version :9

Sequence 1:NP_001027306.1 Gene:His2A:CG33817 / 3772351 FlyBaseID:FBgn0053817 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001190852.1 Gene:HTA2 / 828831 AraportID:AT4G27230 Length:131 Species:Arabidopsis thaliana


Alignment Length:121 Identity:92/121 - (76%)
Similarity:104/121 - (85%) Gaps:2/121 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK--GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63
            |:||||  |.....|:.|||::||||||||||.|.|:.|.||||||||||||||||:||||||||
plant     1 MAGRGKQLGSGAAKKSTSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVL 65

  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119
            |||||||||||||||:|||:|||:||||||:|||..||||.|||:|||..:|||||
plant    66 ELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33817NP_001027306.1 PTZ00017 16..124 CDD:185399 85/104 (82%)
HTA2NP_001190852.1 PLN00157 1..131 CDD:177758 92/121 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 132 1.000 Domainoid score I1660
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I1426
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm981
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X55
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.