DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33817 and h2ax

DIOPT Version :9

Sequence 1:NP_001027306.1 Gene:His2A:CG33817 / 3772351 FlyBaseID:FBgn0053817 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_957367.1 Gene:h2ax / 394048 ZFINID:ZDB-GENE-040426-987 Length:142 Species:Danio rerio


Alignment Length:125 Identity:110/125 - (88%)
Similarity:118/125 - (94%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||:||||||||||:||||||||||||||||||||||||:|||.||:||
Zfish     1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||.:.|
Zfish    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTGQAA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33817NP_001027306.1 PTZ00017 16..124 CDD:185399 97/107 (91%)
h2axNP_957367.1 PTZ00017 1..121 CDD:185399 107/119 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 14/20 (70%)
H2A 6..120 CDD:238029 101/113 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..142 1/3 (33%)
[ST]-Q motif 139..140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4548
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3500
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm6415
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X55
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.