DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and aralar1

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:379 Identity:83/379 - (21%)
Similarity:141/379 - (37%) Gaps:118/379 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQNLRP 120
            |.:...||.|:::||||:|.|   |....:.::.|                              
  Fly   365 GAVGATVVYPIDLVKTRMQNQ---RAGSYIGEVAY------------------------------ 396

  Fly   121 LRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMK 185
             |.:.|.|.|:|...||.||:.||.|.|:...|...|.....:.:::.|:         ::.|  
  Fly   397 -RNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLT---------DKKG-- 449

  Fly   186 DQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVRIKMQ-- 248
                                          ::|.:..:.:|.|:....|....|:|:|:|::|  
  Fly   450 ------------------------------NIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVA 484

  Fly   249 SEYMTYAEL--WRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFS----VTEP 307
            .|..:.:::  |.|:|.|    |:.||::|....::||.|||..|:..|...|...:    ...|
  Fly   485 GEIASGSKIRAWSVVREL----GLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHP 545

  Fly   308 TFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTGAGARPKTPQSA 372
            ..|.:  .|||:|..|..:..|.|:|.|..|:.           |.:|..|.||           
  Fly   546 LTLLA--AGAIAGVPAASLVTPADVIKTRLQVV-----------ARSGQTTYTG----------- 586

  Fly   373 VANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSFFF 426
                   |....::|...:|.|..:.|...|:.|..|...:.:.|:|..:..|:
  Fly   587 -------VWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFY 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 28/114 (25%)
Mito_carr 216..302 CDD:278578 26/89 (29%)
Mito_carr 306..429 CDD:278578 28/121 (23%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 28/125 (22%)
PTZ00169 358..631 CDD:240302 82/375 (22%)
Mito_carr 449..539 CDD:278578 27/125 (22%)
Mito_carr 544..633 CDD:278578 27/119 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.