DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and CG1907

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:392 Identity:90/392 - (22%)
Similarity:125/392 - (31%) Gaps:123/392 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSALVGGLI---TTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKP 111
            :..|.|||.   .|.||.||::||||:|...|                |......|||..|:.  
  Fly    19 IKFLFGGLSGMGATMVVQPLDLVKTRMQISGA----------------GSGKKEYRSSLHCIQ-- 65

  Fly   112 GRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVS 176
                              .||...|...|:.|:...|:.....|......|.|:.:      |..
  Fly    66 ------------------TIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLND------LFR 106

  Fly   177 QKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIE 241
            :||:.|      ||..  |.:...|                      .:|.|...|.    ||.|
  Fly   107 EKFQRS------PGIT--DSMAMGT----------------------IAGACGAFIG----TPAE 137

  Fly   242 MVRIKMQS-------EYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIK 299
            :..::|.|       |...|..:...|..:.|:.|:..||||..|||.|....:.|..|.|...|
  Fly   138 VALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK 202

  Fly   300 RAFS----VTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGT 360
            ..|.    ..|......|....:||.:.|..:||.|:..|..|.....|                
  Fly   203 TYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD---------------- 251

  Fly   361 GAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFE-----Y 420
               .:|:...:|      .||.|   :.|.:||..|:.|..|...|:.|...:.....|     |
  Fly   252 ---GKPEYRGTA------DVLLR---VARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGY 304

  Fly   421 SK 422
            :|
  Fly   305 NK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 29/123 (24%)
Mito_carr 216..302 CDD:278578 25/92 (27%)
Mito_carr 306..429 CDD:278578 27/122 (22%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 30/131 (23%)
Mito_carr 118..207 CDD:278578 27/114 (24%)
Mito_carr 219..307 CDD:278578 26/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.