DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and mfrn

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:399 Identity:86/399 - (21%)
Similarity:148/399 - (37%) Gaps:130/399 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGR 113
            :.:..:.|::...|:.||:.||||:|:     ..|....:..|  :.|.|.:.|..         
  Fly    18 MTAGAIAGVLEHVVMYPLDSVKTRMQS-----LSPPTKNMNIV--STLRTMITREG--------- 66

  Fly   114 DPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQK 178
               .|||:|||                    |..::.|.|:..:||..||..|.       ::.|
  Fly    67 ---LLRPIRGA--------------------SAVVLGAGPAHSLYFAAYEMTKE-------LTAK 101

  Fly   179 FEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAI-TPIEM 242
            |                                .|..:|.|.:   ||..: |::..|| :|.::
  Fly   102 F--------------------------------TSVRNLNYVI---SGAVA-TLIHDAISSPTDV 130

  Fly   243 VRIKMQSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFSV--- 304
            ::.:||.....|..:...:|.:.::.|....:|.:...::.:.|:...::..||..:...::   
  Fly   131 IKQRMQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERK 195

  Fly   305 -TEPTFLFSFLTGAISGAVATFVTMPFDLITT--HTQIELGQDVLYEEIGAGTGAGTGTGAGARP 366
             ..|..:   ..||.:||.|..||.|.|:|.|  :||          |.|...|           
  Fly   196 YNPPVHM---AAGAAAGACAAAVTTPLDVIKTLLNTQ----------ETGLTRG----------- 236

  Fly   367 KTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSFFFHYNLD 431
                         ::...|:||.:.|..|.:.|...|:|..:||.||..||:|:.|  |:...||
  Fly   237 -------------MIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFK--FYLCGLD 286

  Fly   432 LQEAAYRRS 440
            ..:  |:.|
  Fly   287 ADQ--YKSS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 28/121 (23%)
Mito_carr 216..302 CDD:278578 17/86 (20%)
Mito_carr 306..429 CDD:278578 34/124 (27%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 28/125 (22%)
PTZ00168 17..280 CDD:185494 81/382 (21%)
Mito_carr 107..190 CDD:278578 17/86 (20%)
Mito_carr <215..282 CDD:278578 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.