DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Bmcp

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:388 Identity:88/388 - (22%)
Similarity:136/388 - (35%) Gaps:94/388 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IKPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQ-HAIRQRPTVSKLCYVYHNGLMTHVCRSSDI 106
            :|..:..|...|..:...|...|::..|||:|.| ..|.|  :.|:|.|                
  Fly     4 VKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQ--SFSQLRY---------------- 50

  Fly   107 CVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSH 171
                           ||..||||||....|...|::|:.|.::.......|.|.||         
  Fly    51 ---------------RGMTDAFVKISREEGLRALYSGIWPAVLRQATYGTIKFGTY--------- 91

  Fly   172 IYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTA 236
             |.:.:...|.|:   :...||.:.:     ..|:...|             |:|..|..|.   
  Fly    92 -YTLKKLANERGL---LINEDGSERV-----WSNILCAA-------------AAGAISSAIA--- 131

  Fly   237 ITPIEMVRIKMQSEYM-TYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIK- 299
             .|.::::::||.... .:..|......:.:..|:.|||||..||..|....:.....||:..| 
  Fly   132 -NPTDVLKVRMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKL 195

  Fly   300 ---RAFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTG 361
               .||.........|....::..|:|   :.|.|:|.|....:....:        |..|..| 
  Fly   196 QLMNAFGDHVGNHFISSFIASLGSAIA---STPIDVIRTRLMNQRPVSI--------TMNGVVT- 248

  Fly   362 AGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSF 424
            |.|.||....:        |....|..|.:|:..||.|.:|..:|:.|...|...|:|..|.:
  Fly   249 AAATPKLYSGS--------LDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 31/128 (24%)
Mito_carr 216..302 CDD:278578 20/90 (22%)
Mito_carr 306..429 CDD:278578 28/119 (24%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 31/132 (23%)
Mito_carr <132..199 CDD:278578 16/66 (24%)
Mito_carr 204..303 CDD:278578 28/118 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.