DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and CG7514

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:311 Identity:59/311 - (18%)
Similarity:104/311 - (33%) Gaps:105/311 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VGGLITTFVVTPLEVVKTRVQTQHAIRQ-RPTVSKLCYVY--------HNGLMTHVCRSSDICVP 109
            :.|::.|.:|.||::||||:|......: :.:...|..|:        :|||...:.|.:.....
  Fly    21 LAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQATYTTA 85

  Fly   110 KPG----------------------------------------------------RDPQNLRPLR 122
            :.|                                                    ..|...|...
  Fly    86 RMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERRNYT 150

  Fly   123 GAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQ 187
            |.::|||:||...|...||.|..||:..|:...::...:|..:|.:.|..:        ||:   
  Fly   151 GVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF--------SGL--- 204

  Fly   188 VPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVRIKMQSEYM 252
                                        ||.....|.||:    :...|..|::|.:.::|.:..
  Fly   205 ----------------------------SLHIAAAMMSGL----LTTIASMPLDMAKTRIQQQKT 237

  Fly   253 T-YAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAF 302
            . |.....||..:.:..||..||:|:.|.:.|..|.:...:...|.:.:|:
  Fly   238 AEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 34/177 (19%)
Mito_carr 216..302 CDD:278578 21/86 (24%)
Mito_carr 306..429 CDD:278578
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 58/308 (19%)
Mito_carr 19..90 CDD:278578 17/68 (25%)
Mito_carr 104..201 CDD:278578 18/96 (19%)
Mito_carr 207..284 CDD:278578 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.