DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and PMP34

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:378 Identity:93/378 - (24%)
Similarity:138/378 - (36%) Gaps:104/378 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRD 114
            ||...||.|......||:.|::|:|.:.|                         .|:        
  Fly    20 VSGAAGGCIAMSTFYPLDTVRSRLQLEEA-------------------------GDV-------- 51

  Fly   115 PQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKF 179
                   |.......:||...||..|:.||.|.|.|...|..:||.|:..:|...|.    ....
  Fly    52 -------RSTRQVIKEIVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASG----GSPS 105

  Fly   180 EESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVR 244
            :.|.:||.:.|:..|.        |||..|.|....:                     |.:.|..
  Fly   106 QHSALKDLLLGSIAGI--------INVLTTTPFWVVN---------------------TRLRMRN 141

  Fly   245 IKMQSEYMT--YAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKR---AFSV 304
            :...|:.:.  |..|...|:.:..:.||.|||.|..|::|. .......:.:||.:||   .|:.
  Fly   142 VAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLML-VSNPALQFMMYEMLKRNIMRFTG 205

  Fly   305 TEPTFLFSFLTGAISGAVATFVTMPFDLITT---HTQIELGQDVLYEEIGAGTGAGTGTGAGARP 366
            .|...|..|..|||:.|.||.:|.|..|:.|   |...|             :.:...|.||:.|
  Fly   206 GEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKE-------------SDSKPSTSAGSTP 257

  Fly   367 KTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFE 419
            :|         .|.|..|..|.:.||:|||:.|:..::|:.|...|:|...:|
  Fly   258 RT---------ESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 28/120 (23%)
Mito_carr 216..302 CDD:278578 18/90 (20%)
Mito_carr 306..429 CDD:278578 35/117 (30%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 27/115 (23%)
Mito_carr 105..202 CDD:278578 28/126 (22%)
Mito_carr 214..303 CDD:278578 33/110 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.