DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and CG8026

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:394 Identity:84/394 - (21%)
Similarity:146/394 - (37%) Gaps:128/394 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKP 111
            :.:|:.:.||:::|.::.||:::|.|                 :..::|      |::.:     
  Fly    24 EHLVAGVSGGVVSTLILHPLDLIKIR-----------------FAVNDG------RTATV----- 60

  Fly   112 GRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVS 176
               ||    .||...||..|....||.||:.|::|.:..:..|..:||:.|..||..:       
  Fly    61 ---PQ----YRGLSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFI------- 111

  Fly   177 QKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIE 241
                           .||:........:|:.|.|             .|||.  |:::|  .||.
  Fly   112 ---------------QGGNTTMPLGPTMNMLAAA-------------ESGIL--TLLLT--NPIW 144

  Fly   242 MV--RIKMQSEYMTYAE---LWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRA 301
            :|  |:.:|.:..:.||   :...|..:.::.||.||:||:.|. |.........:..||.:|.|
  Fly   145 VVKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPG-MLGVSHGAIQFMTYEELKNA 208

  Fly   302 FS-----------VTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTG 355
            ::           .|.....|:    |:|..:|...|.|:.::....     ||..:...|    
  Fly   209 YNEYRKLPIDTKLATTEYLAFA----AVSKLIAAAATYPYQVVRARL-----QDHHHRYNG---- 260

  Fly   356 AGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEY 420
                                    ....::|.:|.:|.||.|.|:...:.||||||.:....:|.
  Fly   261 ------------------------TWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYEN 301

  Fly   421 SKSF 424
            ...|
  Fly   302 VSHF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 29/123 (24%)
Mito_carr 216..302 CDD:278578 24/90 (27%)
Mito_carr 306..429 CDD:278578 24/119 (20%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 76/374 (20%)
Mito_carr 23..115 CDD:278578 30/147 (20%)
Mito_carr 119..213 CDD:278578 28/111 (25%)
Mito_carr 220..307 CDD:278578 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.