DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and CG4995

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:395 Identity:74/395 - (18%)
Similarity:131/395 - (33%) Gaps:149/395 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICV 108
            |.:...|:.|:||.....|..|.:.||..:||.                                
  Fly    39 KMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTD-------------------------------- 71

  Fly   109 PKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPT-----LVSALPSTIIYFLTYEYIK-- 166
                 ||:|.: .:|....|..||....|.||:.|:|..     ||:|     |.|..|..::  
  Fly    72 -----DPRNPK-YKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNA-----IVFGVYGNVQRL 125

  Fly   167 ----NSL-SHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASG 226
                ||| ||.:               .|:..|                            :|.|
  Fly   126 SNDPNSLTSHFF---------------AGSIAG----------------------------VAQG 147

  Fly   227 -ICSRTIVVTAITPIEMVRIKMQ-----SEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDA 285
             :|:         |:|:.:.::|     ...:.:......|:.:::..||.|.::|...|::||.
  Fly   148 FVCA---------PMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDI 203

  Fly   286 PFSGTYWAVYEAIKRAFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIE-LGQDVLYEE 349
            |...:|:..:|.:.|  .|..|...::.:.|..:|..:.....|.|::.||.|.: ||.:..|. 
  Fly   204 PGFASYFVSFEYLMR--QVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYN- 265

  Fly   350 IGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVP---AC 411
                                         ..:....:.:|.:|.:..:.|:...::|..|   ||
  Fly   266 -----------------------------GFIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAAC 301

  Fly   412 AIMIS 416
            ..::|
  Fly   302 FFVVS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 32/138 (23%)
Mito_carr 216..302 CDD:278578 18/91 (20%)
Mito_carr 306..429 CDD:278578 19/115 (17%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 29/128 (23%)
PTZ00169 41..295 CDD:240302 69/380 (18%)
Mito_carr 128..218 CDD:278578 24/141 (17%)
Mito_carr 221..304 CDD:278578 18/112 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.