DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Ucp4B

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:437 Identity:88/437 - (20%)
Similarity:146/437 - (33%) Gaps:136/437 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SQMENGGEEEGCRLECKEMDPLRLTTLILSADPRYRIKPMQQVVSALVGGLITTFVVTPLEVVKT 71
            ::.:|..|:|..:||       .|.|       ..:..|::..::|.........|..|.::.||
  Fly    12 AEWDNSEEKERPKLE-------YLVT-------NKKTPPVELYLTAFASACSAEIVGYPFDMCKT 62

  Fly    72 RVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSG 136
            |:|.|..|..| ...|..|                               ||.:...:.||...|
  Fly    63 RMQIQGEIASR-VGQKAKY-------------------------------RGLLATAMGIVREEG 95

  Fly   137 FSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPLD--- 198
            ...|:.|:|..|......:.|..|||:|::..:.                 ||..||...|.   
  Fly    96 LLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMI-----------------VPDEDGRPQLSFLG 143

  Fly   199 QATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVRIKMQSEYM--------TYA 255
            ....|:...|||.|.|                       .|.|:::|:||.|..        ...
  Fly   144 SCISGVLAGATASVLT-----------------------NPTELIKIQMQMEGQRRLRGEPPRIH 185

  Fly   256 ELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFSVTEPTFL----FSFLTG 316
            .:.:.|.|:.|..|::|||:|..|...|.|..:....:.|:..|| |.:.|...:    ..|:..
  Fly   186 NVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKR-FLIAEFDLVDNREVQFVAA 249

  Fly   317 AISGAVATFVTMPFDLITTHTQ----IELGQDVLYEEIGAGTGAGTGTGAGARPKTPQSAVANSR 377
            ..:|.....:::|.|::.:...    .|.|:.:.|:                             
  Fly   250 MTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYK----------------------------- 285

  Fly   378 PSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSF 424
             ..|..:.::.|.:|...:|.|.:|..:||.||..:...|||..:.|
  Fly   286 -GSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 27/129 (21%)
Mito_carr 216..302 CDD:278578 20/93 (22%)
Mito_carr 306..429 CDD:278578 22/127 (17%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 71/376 (19%)
Mito_carr 32..129 CDD:278578 27/128 (21%)
Mito_carr 138..233 CDD:278578 28/118 (24%)
Mito_carr 246..331 CDD:278578 20/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.