DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Ucp4C

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:427 Identity:85/427 - (19%)
Similarity:143/427 - (33%) Gaps:158/427 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EMDPLRLTTLILSADPRYR----IKPM------QQVVSALVGGLITTFVVTPLEVVKTRVQTQHA 78
            |.|...|.:|.:..:||:.    ..|:      |..|:..:|..:....|.||:|.|||:|.   
  Fly     5 ERDYWHLRSLEIEEEPRFPPTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQV--- 66

  Fly    79 IRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQNLRPLRGAMDAF----VKIVCTSGFSG 139
                                               |.:..:....||..|    ..::...||..
  Fly    67 -----------------------------------DGEQAKKTGKAMPTFRATLTNMIRVEGFKS 96

  Fly   140 LWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHI--------YLVSQKFEESGMKDQVPGADGGDP 196
            |:||.|.            .:|..:|.|||..:        :|...:..|..:|           
  Fly    97 LYAGFSA------------MVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLK----------- 138

  Fly   197 LDQATRGINVSATAPVSTASLPYYVPMASGICSRT---IVVTAITPIEMVRIKMQSE-------Y 251
                                    :.||.| ||.|   |......|.::|:::||:|       |
  Fly   139 ------------------------IYMALG-CSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGY 178

  Fly   252 -MTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFS----GTYWAVYEAIKRAFSVTEPTFLF 311
             :....:.:....:.|:.|:..:|:|..|:.||....:    |:|.......||...:.|...| 
  Fly   179 DVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPL- 242

  Fly   312 SFLTGAISGAVATFVTMPFDLITTHTQ----IELGQDVLYEEIGAGTGAGTGTGAGARPKTPQSA 372
            .|::...:|..|:.::.|.|:|.:...    .|.|:::.|:                        
  Fly   243 RFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYK------------------------ 283

  Fly   373 VANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVP 409
              ||    |..:|::.|.:||..||.|:||...|:.|
  Fly   284 --NS----LDCVRKLVREEGVLTLYKGLMPTWFRLGP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 27/143 (19%)
Mito_carr 216..302 CDD:278578 24/100 (24%)
Mito_carr 306..429 CDD:278578 25/108 (23%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 23/124 (19%)
Mito_carr 137..232 CDD:278578 23/130 (18%)
Mito_carr 237..329 CDD:278578 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.