DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and colt

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:393 Identity:79/393 - (20%)
Similarity:125/393 - (31%) Gaps:114/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RIKPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDI 106
            :..|::..::...||:.......||:.:|.|:||...                            
  Fly    12 KANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPR---------------------------- 48

  Fly   107 CVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSH 171
              |.||..|.    .||..|...|.:...|..||:.|:|..|....|...:.|..|..       
  Fly    49 --PAPGEQPL----YRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYAL------- 100

  Fly   172 IYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTA 236
                       |.:.|..|.|                      |.|.|.....:|..|.......
  Fly   101 -----------GKRLQQRGED----------------------AKLTYPQIFVAGSFSGLFSTLI 132

  Fly   237 ITPIEMVRIKMQSEY-----MTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYE 296
            :.|.|.:::.:|::.     ..|..:......|.::.|:..:::|...|::||.|.:|.|:.|||
  Fly   133 MAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYE 197

  Fly   297 AIKRAFSVTEPTFLFS----FLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAG 357
            |::........|...|    ...|.::|.....:.||.|::.:..|                .|.
  Fly   198 ALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQ----------------SAP 246

  Fly   358 TGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSK 422
            .||               .:..:.|..:.:....|...||.||.|.|||..||.|......|.:.
  Fly   247 EGT---------------YKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELAN 296

  Fly   423 SFF 425
            .||
  Fly   297 KFF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 26/128 (20%)
Mito_carr 216..302 CDD:278578 21/90 (23%)
Mito_carr 306..429 CDD:278578 27/124 (22%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 28/146 (19%)
Mito_carr 112..202 CDD:395101 21/89 (24%)
Mito_carr 210..299 CDD:395101 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.