DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Rim2

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:423 Identity:90/423 - (21%)
Similarity:151/423 - (35%) Gaps:155/423 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GLITTFVVTPLEVVKTRVQTQHAI--------------------------------------RQR 82
            |.:...|..||||||||:|:..|.                                      |.:
  Fly    19 GTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTILRNRSQ 83

  Fly    83 PT----VSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAG 143
            |.    |.::..:.|.|:.:...:|..|.        |.||          .||...|...|:.|
  Fly    84 PQVIGGVRRIMAISHCGISSTTPKSMSIV--------QCLR----------HIVQNEGPRALFKG 130

  Fly   144 LSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSA 208
            |.|.||...||..|||.||...||:|:.:..|.:                ..||      :::.:
  Fly   131 LGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVER----------------DSPL------VHIMS 173

  Fly   209 TAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVRIKMQSEYMTYAELW--RVLRSLIRQHGIL 271
            .|             ::|..|.    ||..||..|:.:||.:|.:..::.  :.:..:..|.|:.
  Fly   174 AA-------------SAGFVSS----TATNPIWFVKTRMQLDYNSKVQMTVRQCIERVYAQGGVA 221

  Fly   272 GLWRGWPPTVMRDAPFSG-----TYWAVYEAIK--------RAFSVTEPT--FLFSFLTGAISGA 321
            ..::|      ..|.:.|     .::.:||.||        :..:.|:.:  ||...:.||:|..
  Fly   222 AFYKG------ITASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRDFLEFMMAGAVSKT 280

  Fly   322 VATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQ 386
            :|:.:..|.::..|.         |.||                        .|...|....:..
  Fly   281 IASCIAYPHEVARTR---------LREE------------------------GNKYNSFWQTLHT 312

  Fly   387 IYRLQGVRGLYVGVMPRMLRVVPACAIMISTFE 419
            :::.:|..|||.|:..:::|.:|..|||::|:|
  Fly   313 VWKEEGRAGLYRGLATQLVRQIPNTAIMMATYE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 41/156 (26%)
Mito_carr 216..302 CDD:278578 19/100 (19%)
Mito_carr 306..429 CDD:278578 25/116 (22%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 40/154 (26%)
Mito_carr 163..253 CDD:278578 22/134 (16%)
Mito_carr 268..355 CDD:278578 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.