DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and CG1628

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:395 Identity:87/395 - (22%)
Similarity:133/395 - (33%) Gaps:146/395 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQNL 118
            :||....:|..||:.||.::||                                .|:        
  Fly   178 LGGAAQVYVSQPLDTVKVKLQT--------------------------------FPE-------- 202

  Fly   119 RPLRGAMDAFVKIVCTSG-FSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKF--- 179
             ..||.:|.|:......| ..||:||..|.:.:.:....:.|..|.           ..|||   
  Fly   203 -AYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFANVAENSVLFAAYG-----------GCQKFVAF 255

  Fly   180 ----EESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPI 240
                |.:|....|..|..|            |..|..||.:|          |          |.
  Fly   256 CVGKETAGDLTTVQNACAG------------SLAACFSTLTL----------C----------PT 288

  Fly   241 EMVRIKMQS--EYMTYAE---------LWRVLRSLIRQHGILGLWRGWPPTVMRDAP----FSGT 290
            |:::.|:|:  |...:.|         .|.:.|.:.|..||.|.:||...|.:|:.|    |.|:
  Fly   289 ELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGS 353

  Fly   291 YWAVYEAIKRAFSVTE---PTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGA 352
            |....|.::|.....:   |  |.:.:.|||.|......|.|.|:|.:..|::            
  Fly   354 YEGTRELLRRDDQSKDDIGP--LRTMIAGAIGGVCLWTSTFPADVIKSRIQVK------------ 404

  Fly   353 GTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMIST 417
                                  |...|:.:....|.|.:||..||.|::|.:||.:||.|.:...
  Fly   405 ----------------------NLNESMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVV 447

  Fly   418 FEYSK 422
            :||:|
  Fly   448 YEYTK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 22/117 (19%)
Mito_carr 216..302 CDD:278578 24/100 (24%)
Mito_carr 306..429 CDD:278578 29/120 (24%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 87/395 (22%)
Mito_carr 170..252 CDD:278578 23/125 (18%)
Mito_carr 263..364 CDD:278578 31/132 (23%)
Mito_carr 369..455 CDD:278578 29/120 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.