DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Slc25a38

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001025203.2 Gene:Slc25a38 / 301067 RGDID:1311914 Length:326 Species:Rattus norvegicus


Alignment Length:398 Identity:95/398 - (23%)
Similarity:146/398 - (36%) Gaps:149/398 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MQQVVSAL----VGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDI 106
            :..|:.|.    :.|..:|.:..||:::|||:||                               
  Rat    44 LHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQT------------------------------- 77

  Fly   107 CVPKPGRDPQNLRPLR-GAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLS 170
                  ..|.::.|.| |.:..|:|:|.|....|||.|:||::|..:|...|||.|         
  Rat    78 ------LQPSDVGPRRVGMLSVFLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGT--------- 127

  Fly   171 HIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVT 235
             :|...|.|..            |.|              |.:..|      :..|:.||::...
  Rat   128 -LYSSKQYFLR------------GHP--------------PTALES------VILGMGSRSVAGV 159

  Fly   236 AITPIEMVRIKMQSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKR 300
            .::||.:|:.:.:|...:|..::..|||:....|..||:||...|::|||||||.|...|     
  Rat   160 CMSPITVVKTRYESGAYSYESVYAALRSIYCSEGSRGLFRGLTATLLRDAPFSGLYLMFY----- 219

  Fly   301 AFSVTEPTF-------------LFSFLTGAISGAVATFVTMPFDLITTHTQIE------LGQDVL 346
              |.|..|.             |.:|..|..:|.:|:.||.|.|:|.||.|:.      :||   
  Rat   220 --SQTRATVLHGADELDAALMPLVNFSCGVFAGILASLVTQPADVIKTHMQLSTVKCQCIGQ--- 279

  Fly   347 YEEIGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPAC 411
                                      ||.          .|.:..|:||.:.|.:||.||.....
  Rat   280 --------------------------VAT----------LILKTHGLRGFFHGSVPRALRRTLMA 308

  Fly   412 AIMISTFE 419
            |:..:.:|
  Rat   309 AMAWTVYE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 31/129 (24%)
Mito_carr 216..302 CDD:278578 27/85 (32%)
Mito_carr 306..429 CDD:278578 29/133 (22%)
Slc25a38NP_001025203.2 Solcar 1. /evidence=ECO:0000255|HAMAP-Rule:MF_03064 45..134 32/135 (24%)
Mito_carr 46..137 CDD:395101 34/137 (25%)
Mito_carr 140..223 CDD:395101 30/109 (28%)
Solcar 2. /evidence=ECO:0000255|HAMAP-Rule:MF_03064 141..225 30/96 (31%)
Solcar 3. /evidence=ECO:0000255|HAMAP-Rule:MF_03064 237..321 28/119 (24%)
Mito_carr 239..326 CDD:395101 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.