DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33853 and HTA12

DIOPT Version :9

Sequence 1:NP_001027366.1 Gene:His2A:CG33853 / 3772346 FlyBaseID:FBgn0053853 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001190208.1 Gene:HTA12 / 831891 AraportID:AT5G02560 Length:177 Species:Arabidopsis thaliana


Alignment Length:147 Identity:91/147 - (61%)
Similarity:102/147 - (69%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRGKGGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE----- 61
            :||..||..|.|..|||.::|||||||||.|.|:||.|::|||.|||||||||:||||||     
plant    12 AGRRSGGGPKKKPVSRSVKSGLQFPVGRIGRYLKKGRYSKRVGTGAPVYLAAVLEYLAAENSCGF 76

  Fly    62 -------------------VLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGV 107
                               ||||||||||||||.||||||:.||:||||||..||.|||||.|||
plant    77 CSVASLTIYRCRMSSSDFRVLELAGNAARDNKKNRIIPRHVLLAVRNDEELGTLLKGVTIAHGGV 141

  Fly   108 LPNIQAVLLPKKTEKKA 124
            ||||..:|||||:||.|
plant   142 LPNINPILLPKKSEKAA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33853NP_001027366.1 H2A 16..121 CDD:197711 82/128 (64%)
H2A 16..119 CDD:238029 80/126 (63%)
HTA12NP_001190208.1 PLN00157 20..164 CDD:177758 87/139 (63%)
H2A 20..153 CDD:238029 82/132 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4215
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.