DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33853 and LOC570115

DIOPT Version :10

Sequence 1:NP_001027366.1 Gene:His2A:CG33853 / 3772346 FlyBaseID:FBgn0053853 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_698647.3 Gene:LOC570115 / 570115 -ID:- Length:269 Species:Danio rerio


Alignment Length:125 Identity:112/125 - (89%)
Similarity:118/125 - (94%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||.||||||||||:||||||||||||||||||||||||:|||.||:||
Zfish     1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||||.|
Zfish    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33853NP_001027366.1 PTZ00017 16..124 CDD:185399 99/107 (93%)
LOC570115XP_698647.3 PTZ00017 1..130 CDD:185399 112/125 (90%)
PTZ00017 142..269 CDD:185399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.