DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33853 and macroh2a2

DIOPT Version :9

Sequence 1:NP_001027366.1 Gene:His2A:CG33853 / 3772346 FlyBaseID:FBgn0053853 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001020673.1 Gene:macroh2a2 / 558711 ZFINID:ZDB-GENE-050913-114 Length:367 Species:Danio rerio


Alignment Length:119 Identity:80/119 - (67%)
Similarity:92/119 - (77%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65
            ||.|  |||.|....|||.|||:.|||||:.|.||.|.:..|:|.|||||:|||:||||||:|||
Zfish     1 MSAR--GGKKKITKLSRSARAGVIFPVGRMMRYLRTGTHKYRIGMGAPVYMAAVIEYLAAEILEL 63

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119
            ||||||||||.||.|||::||:.||||||:||.||||:.|||||.|...||.||
Zfish    64 AGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33853NP_001027366.1 H2A 16..121 CDD:197711 73/104 (70%)
H2A 16..119 CDD:238029 71/102 (70%)
macroh2a2NP_001020673.1 H2A 5..117 CDD:238029 75/111 (68%)
H2A 14..119 CDD:197711 73/104 (70%)
Macro_H2A_like 173..359 CDD:239232
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.