DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33853 and H2ac10

DIOPT Version :9

Sequence 1:NP_001027366.1 Gene:His2A:CG33853 / 3772346 FlyBaseID:FBgn0053853 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_783592.1 Gene:H2ac10 / 319173 MGIID:2448309 Length:130 Species:Mus musculus


Alignment Length:122 Identity:109/122 - (89%)
Similarity:115/122 - (94%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||.||||||||||:|||||||||:||||||||||||||:|||.||:||
Mouse     1 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121
            |||||||||||||||||||||||||||||||||..||||||||||||||||||||||
Mouse    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33853NP_001027366.1 H2A 16..121 CDD:197711 95/104 (91%)
H2A 16..119 CDD:238029 93/102 (91%)
H2ac10NP_783592.1 PTZ00017 1..130 CDD:185399 109/122 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 14/20 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4550
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3559
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm8862
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X55
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.