DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33853 and H2ac1

DIOPT Version :10

Sequence 1:NP_001027366.1 Gene:His2A:CG33853 / 3772346 FlyBaseID:FBgn0053853 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_068611.1 Gene:H2ac1 / 24828 RGDID:3854 Length:130 Species:Rattus norvegicus


Alignment Length:122 Identity:107/122 - (87%)
Similarity:113/122 - (92%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            ||||.| |||.:.||||||.||||||||||:|||||:||||||:|||.|||||||:|||.||:||
  Rat     1 MSGRAKQGGKARAKAKSRSFRAGLQFPVGRVHRLLRQGNYAERIGAGTPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121
            |||||||||||||||||||||||||||||||||..||||||||||||||||||||||
  Rat    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33853NP_001027366.1 PTZ00017 16..124 CDD:185399 96/106 (91%)
H2ac1NP_068611.1 PTZ00017 1..123 CDD:185399 107/122 (88%)
[ST]-Q motif 127..128
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.