DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33853 and h2af1al

DIOPT Version :9

Sequence 1:NP_001027366.1 Gene:His2A:CG33853 / 3772346 FlyBaseID:FBgn0053853 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001340863.1 Gene:h2af1al / 100332229 ZFINID:ZDB-GENE-160922-1 Length:140 Species:Danio rerio


Alignment Length:124 Identity:94/124 - (75%)
Similarity:105/124 - (84%) Gaps:3/124 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAK---SRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV 62
            ||||||......|:|   |||.|||||||||||.|||||||:|.|:|:||.|||.||:|||.|||
Zfish     1 MSGRGKKLAAPQKSKTSVSRSARAGLQFPVGRIARLLRKGNFAARIGSGAAVYLTAVIEYLCAEV 65

  Fly    63 LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121
            |||||||:|||||.||.|||:|||:|||||||.||.||||::||||||||||||||||:
Zfish    66 LELAGNASRDNKKLRIAPRHIQLAVRNDEELNTLLGGVTISEGGVLPNIQAVLLPKKTK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33853NP_001027366.1 H2A 16..121 CDD:197711 85/104 (82%)
H2A 16..119 CDD:238029 83/102 (81%)
h2af1alNP_001340863.1 PTZ00017 1..138 CDD:185399 94/124 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.