DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33814 and H2aj

DIOPT Version :10

Sequence 1:NP_001027301.1 Gene:His2A:CG33814 / 3772345 FlyBaseID:FBgn0053814 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001103080.1 Gene:H2aj / 690795 RGDID:1592176 Length:129 Species:Rattus norvegicus


Alignment Length:124 Identity:112/124 - (90%)
Similarity:118/124 - (95%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| ||||:.||||||:||||||||||:||||||||||||||||||||||||:|||.||:||
  Rat     1 MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123
            |||||||||||||||||||||||||||||||||..||||||||||||||||||||||.:
  Rat    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESQ 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33814NP_001027301.1 PTZ00017 16..124 CDD:185399 99/108 (92%)
H2ajNP_001103080.1 PTZ00017 1..129 CDD:185399 112/124 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 16/20 (80%)

Return to query results.
Submit another query.