DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33814 and hta2

DIOPT Version :10

Sequence 1:NP_001027301.1 Gene:His2A:CG33814 / 3772345 FlyBaseID:FBgn0053814 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_594421.1 Gene:hta2 / 2542226 PomBaseID:SPAC19G12.06C Length:131 Species:Schizosaccharomyces pombe


Alignment Length:124 Identity:100/124 - (80%)
Similarity:109/124 - (87%) Gaps:2/124 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGK--VKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63
            |||...|||  |...|:|||.:|||.|||||:||||||||||:|||||||||||||:||||||:|
pombe     1 MSGGKSGGKAAVAKSAQSRSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEIL 65

  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122
            ||||||||||||||||||||||||||||||||||..||||||||:|||.|.||||::.|
pombe    66 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPKQSGK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33814NP_001027301.1 PTZ00017 16..124 CDD:185399 92/107 (86%)
hta2NP_594421.1 PTZ00017 4..130 CDD:185399 97/121 (80%)

Return to query results.
Submit another query.