DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33814 and H2AC1

DIOPT Version :9

Sequence 1:NP_001027301.1 Gene:His2A:CG33814 / 3772345 FlyBaseID:FBgn0053814 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_734466.1 Gene:H2AC1 / 221613 HGNCID:18729 Length:131 Species:Homo sapiens


Alignment Length:122 Identity:110/122 - (90%)
Similarity:117/122 - (95%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|:||||:|||||||||||||||||||||||:|||||||||||:|||.||:||
Human     1 MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121
            |||||:|||||||||||||||||||||||||||.|||||||||||||||||||||||
Human    66 LAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33814NP_001027301.1 PTZ00017 16..124 CDD:185399 99/106 (93%)
H2AC1NP_734466.1 PTZ00017 1..131 CDD:185399 110/122 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 15/21 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4580
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3563
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm8629
orthoMCL 1 0.900 - - OOG6_100077
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X55
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.