DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and RPC11

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_010330.1 Gene:RPC11 / 851615 SGDID:S000002452 Length:110 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:60/119 - (50%)
Similarity:73/119 - (61%) Gaps:21/119 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFFCPSCGNILIIEE-DTNCHRFTCNTCPYISKI-------RRKISTKTFPRLKEVDHVLGGKA 57
            ||.|||||.|:|:|.. |:..:...|.:|||...|       |:|:     || ||||.||||  
Yeast     1 MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKL-----PR-KEVDDVLGG-- 57

  Fly    58 AWENVDSTDAECP---TCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            .|:|||.|..:||   |||.:.|||.|:|.|||||||||||||.|  |.|.|::
Yeast    58 GWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVN--CGHRWKE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 60/117 (51%)
RPC11NP_010330.1 RPB9 1..110 CDD:224510 60/119 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341927
Domainoid 1 1.000 60 1.000 Domainoid score I2584
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5610
Inparanoid 1 1.050 110 1.000 Inparanoid score I1382
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54273
OrthoFinder 1 1.000 - - FOG0004777
OrthoInspector 1 1.000 - - oto99303
orthoMCL 1 0.900 - - OOG6_101491
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1188
SonicParanoid 1 1.000 - - X3361
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.