DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and AT1G01210

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001322609.1 Gene:AT1G01210 / 839481 AraportID:AT1G01210 Length:106 Species:Arabidopsis thaliana


Alignment Length:107 Identity:47/107 - (43%)
Similarity:65/107 - (60%) Gaps:6/107 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTKTFPRL--KEVDHVLGGKAAWENVDSTD 66
            |||:|||:|..|...| .||.|:||||::.|:|::..|....|  |.::.|: .|........|:
plant     3 FCPTCGNLLRYEGGGN-SRFFCSTCPYVAYIQRQVEIKKKQLLVKKSIEAVV-TKDDIPTAAETE 65

  Fly    67 AECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            |.||.|||.:|||..:|.||||||.:.||:|.  :|..|||:
plant    66 APCPRCGHDKAYFKSMQIRSADEPESRFYRCL--KCEFTWRE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 46/105 (44%)
AT1G01210NP_001322609.1 RPB9 1..105 CDD:224510 46/105 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4058
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2272
OMA 1 1.010 - - QHG54273
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004777
OrthoInspector 1 1.000 - - otm3381
orthoMCL 1 0.900 - - OOG6_101491
Panther 1 1.100 - - LDO PTHR11239
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3361
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.