DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr3K and AT3G25940

DIOPT Version :10

Sequence 1:NP_001027443.1 Gene:Polr3K / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_566786.1 Gene:AT3G25940 / 822191 AraportID:AT3G25940 Length:119 Species:Arabidopsis thaliana


Alignment Length:130 Identity:34/130 - (26%)
Similarity:49/130 - (37%) Gaps:47/130 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCPSCGNILIIE-----EDTNCHRFTCNTCPYISK----------IRRKISTKTF---------- 43
            ||..||.:|:::     |..:| :.|.|....|.|          |||::....|          
plant    11 FCNLCGTMLVLKSTKYAECPHC-KTTRNAKDIIDKEIAYTVSAEDIRRELGISLFGEKTQAEAEL 74

  Fly    44 PRLKEVDHVLGGKAAWENVDSTDAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            |::|:.                   |..|.|....:...|||||||..||:|.|.|  |.|.:.:
plant    75 PKIKKA-------------------CEKCQHPELVYTTRQTRSADEGQTTYYTCPN--CAHRFTE 118

  Fly   109  108
            plant   119  118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr3KNP_001027443.1 RPB9 4..107 CDD:441202 34/127 (27%)
Zn-ribbon_RPC11 61..108 CDD:259794 17/46 (37%)
AT3G25940NP_566786.1 RPB9 11..115 CDD:441202 33/125 (26%)
Zn-ribbon_RPA12 75..118 CDD:259792 19/63 (30%)

Return to query results.
Submit another query.