DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and POLR2I

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_006224.1 Gene:POLR2I / 5438 HGNCID:9196 Length:125 Species:Homo sapiens


Alignment Length:118 Identity:32/118 - (27%)
Similarity:50/118 - (42%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCPSCGNILIIEED----------TNC--HRFTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGK 56
            ||..|.|:|..:||          .||  .:...|:|.|::||..::.        |:..::...
Human    16 FCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVD--------ELTQIIADV 72

  Fly    57 AAWENVDST-DAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNHECNHTWRD 108
            :....:..| |..|..||||.|.|.|..:..|::.|..:|.|....|.|.|.:
Human    73 SQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 32/116 (28%)
POLR2INP_006224.1 RPB9 14..125 CDD:224510 32/116 (28%)
Zn-ribbon_RPB9 74..124 CDD:259793 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.