DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and polr1h

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001013572.1 Gene:polr1h / 541428 ZFINID:ZDB-GENE-050320-131 Length:118 Species:Danio rerio


Alignment Length:111 Identity:30/111 - (27%)
Similarity:41/111 - (36%) Gaps:30/111 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGKAAWENVDST--- 65
            |||.|||||.:....|  ..||..|.:      |||.:.|     ...|:.....:..:|.:   
Zfish    10 FCPECGNILPLPSRLN--TITCPRCSF------KISVQDF-----TSQVIKSSVMFNPLDQSNVA 61

  Fly    66 --------------DAECPTCGHKRAYFMQIQTRSADEPMTTFYKC 97
                          |.:|..|..:...:...|.|||||..|.|:.|
Zfish    62 VGSAEDAELKGPVIDRKCSRCNKEGMVYHTRQMRSADEGQTVFFTC 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 30/111 (27%)
polr1hNP_001013572.1 RPB9 10..117 CDD:224510 30/111 (27%)
Zn-ribbon_RPA12 71..117 CDD:259792 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.