DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr3K and AT1G20065

DIOPT Version :10

Sequence 1:NP_001027443.1 Gene:Polr3K / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001185044.1 Gene:AT1G20065 / 5007707 AraportID:AT1G20065 Length:91 Species:Arabidopsis thaliana


Alignment Length:71 Identity:13/71 - (18%)
Similarity:18/71 - (25%) Gaps:47/71 - (66%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LFFCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGKAAWENVDSTD 66
            :.||..||.:|:::                       |||.                        
plant     9 ILFCNLCGTMLVLK-----------------------STKY------------------------ 26

  Fly    67 AECPTC 72
            ||||.|
plant    27 AECPLC 32

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr3KNP_001027443.1 RPB9 4..107 CDD:441202 13/69 (19%)
Zn-ribbon_RPC11 61..108 CDD:259794 5/12 (42%)
AT1G20065NP_001185044.1 None

Return to query results.
Submit another query.