powered by:
Protein Alignment Polr3K and AT1G20065
DIOPT Version :10
| Sequence 1: | NP_001027443.1 |
Gene: | Polr3K / 3772344 |
FlyBaseID: | FBgn0061362 |
Length: | 108 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001185044.1 |
Gene: | AT1G20065 / 5007707 |
AraportID: | AT1G20065 |
Length: | 91 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 71 |
Identity: | 13/71 - (18%) |
| Similarity: | 18/71 - (25%) |
Gaps: | 47/71 - (66%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 LFFCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTKTFPRLKEVDHVLGGKAAWENVDSTD 66
:.||..||.:|::: |||.
plant 9 ILFCNLCGTMLVLK-----------------------STKY------------------------ 26
Fly 67 AECPTC 72
||||.|
plant 27 AECPLC 32
|
Known Domains:
Indicated by green bases in alignment.
Return to query results.
Submit another query.