DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33785 and RpI12

DIOPT Version :9

Sequence 1:NP_001027443.1 Gene:CG33785 / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster


Alignment Length:115 Identity:30/115 - (26%)
Similarity:46/115 - (40%) Gaps:36/115 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCPSCGNI---LIIEEDTNCH----------------RFTCNTCPYISKIRRKISTKTFPRLKEV 49
            ||||||:|   |.::.:..|:                .||.:...|       ..:|.|.|.|  
  Fly    10 FCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTIHFNTY-------DPSKVFNRTK-- 65

  Fly    50 DHVLGGKAAWENVDS--TDAECPTCGHKRAYFMQIQTRSADEPMTTFYKC 97
                  :.:..:.|.  .:.:||.|.|.:..:..:|.|||||..|.|:.|
  Fly    66 ------RESESDADGPVVERKCPKCNHDKMSYATLQLRSADEGQTVFFTC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33785NP_001027443.1 RPB9 1..108 CDD:224510 30/115 (26%)
RpI12NP_524439.1 RPB9 10..119 CDD:224510 30/115 (26%)
Zn-ribbon_RPA12 73..119 CDD:259792 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442319
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11239
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.